PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 292aa    MW: 34825 Da    PI: 7.025
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.17.8e-2639121186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +e+++Li++r e+++++ ++k++k lWe+vs+kmr + f rsp+qCk+kw+nl +r+k +++++++    +++++p++d+++
  XP_013634279.1  39 QWSVEETKELIAIRGELDQTFMETKRNKLLWEDVSNKMRNKSFLRSPEQCKCKWKNLVTRFKGCETMDEEI---AKQQFPFYDDMH 121
                     7********************************************************************97...45579*****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00123698IPR001005SANT/Myb domain
CDDcd122035.64E-2238103No hitNo description
PfamPF138371.0E-2039121No hitNo description
PROSITE profilePS500907.6544096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDQHQLHQLH YLNKHHHQLH PQSQTPELAS PATGDRFPQW SVEETKELIA IRGELDQTFM  60
ETKRNKLLWE DVSNKMRNKS FLRSPEQCKC KWKNLVTRFK GCETMDEEIA KQQFPFYDDM  120
HIIFASRMQR MIWAESEGGG GTSGATRKRS QSEQFSSDEE EENVNEELVD ISNEPKTQNP  180
KKNIAKKRKG GISNSSGGAN NSVREVLDEF MRHQMRMENE WRERWEAREK ERAEKEEEWR  240
RKMEELEKDR MAMERMWRDR EEQRRSREDL RAEKRDSLIN ALLAKLTRDG SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1336117384DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179188PKKNIAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634279.10.0PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_013705349.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804501e-120TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A078DW330.0A0A078DW33_BRANA; BnaC04g07120D protein
TrEMBLA0A0D3BQZ20.0A0A0D3BQZ2_BRAOL; Uncharacterized protein
STRINGBra005127.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-96Trihelix family protein